PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400060693
Common NameLOC102592758
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 315aa    MW: 35139.7 Da    PI: 9.7809
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400060693genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.5e-18233267135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  PGSC0003DMP400060693 233 CSHCGVQKTPQWRTGPMGAKTLCNACGVRFKSGRL 267
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.7E-17227281IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.714227263IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.61E-14229290No hitNo description
Gene3DG3DSA:3.30.50.107.0E-15231265IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.13E-14232289No hitNo description
PfamPF003203.1E-16233267IPR000679Zinc finger, GATA-type
PROSITE patternPS003440233258IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MISPYKFHRL SHTPISHSML YRTAPHYSSS PLQGMDSFEK ALKTSYFRPE IAMKMTHHQS  60
SVDDFLVDNL LDLANGFAED EIEQLNEHPN GFNTQKPCSV SPQKKMEPEN GYFGCELSFP  120
ENGLDNLEWL SQFVEEDSYS GYSLIGKLPV KKNQSVTENP VQVNSCFTAP VQTKPRTKRG  180
RIGGRVWSFT GSSTSSASSS TTTTTAESIV RFPAPVNKRR KMTAEKPVQP RRCSHCGVQK  240
TPQWRTGPMG AKTLCNACGV RFKSGRLLPE YRPACSPTFS SERHSNNHRK VLEMRQKKEA  300
GTGGARFAPP VHSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343381.20.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH573e-55GATA5_ARATH; GATA transcription factor 5
TrEMBLM1DH950.0M1DH95_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000890180.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.26e-53GATA transcription factor 5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]